AKSH Engineering Systems Pvt Ltd designs and manufactures industrial spray dryers, evaporators, and turnkey drying & evaporation systems, built by technocrats with over 100 years of combined experience.

Subscribe & Follow

Spin Flash Dryer

Spin Flash Dryer
Since 2013
Made in India
100+ Installations
Drying Systems

Spin Flash Dryer

Swirl Agitated Spin Flash Dryers by AKSH Engineering for continuous drying of sticky wet cakes and pastes. Combines mechanical agitation with swirling hot air to deliver instant moisture removal, integrated particle classification, and high energy savings

SKU: AKSH-SWIRLAGITATEDSPINFLASHDRYER
Made to Order
Starting From
₹30,00,000
Ex-works Ahmedabad · GST extra · Configuration-based pricing

Industrial Swirl Agitated Spin Flash Dryers & Processing Plants

AKSH Engineering Systems Pvt. Ltd. is a leading manufacturer, supplier, and global exporter of high-efficiency Swirl Agitated Spin Flash Dryers based in Ahmedabad, Gujarat, India. Designed specifically for continuous, rapid drying of high-viscosity pastes, cohesive filter cakes, sludges, and wet powders, our spin flash drying systems combine mechanical agitation with tangential hot airflow to achieve instant surface moisture evaporation.

Whether processing heat-sensitive dye intermediates, agrochemical filter cakes, food starches, or mineral pastes, AKSH Engineering custom-engineers swirl agitated drying plants tailored to your exact feed moisture, bulk density, thermal limits, and production throughput requirements.

What is a Swirl Agitated Spin Flash Dryer?

A Swirl Agitated Spin Flash Dryer consists of a vertical cylindrical drying chamber equipped with a bottom mechanical agitator and tangential hot air inlets. As wet cake or paste is metered into the chamber by a heavy-duty feed screw, high-speed agitator blades break down lumps and disintegrate cohesive masses into fine particles.

Simultaneously, hot air entering tangentially creates a high-velocity swirling vortex inside the drying chamber. The lighter, dried micro-particles are swept upward by the swirling air column into the classifier, while heavier, moist particles remain in the agitation zone until fully dried and disintegrated.

Key Advantages of AKSH Swirl Agitated Spin Flash Dryers

  • Continuous Processing of Cohesive Feeds: Effortlessly handles sticky filter cakes, high-solids pastes, and thixotropic materials without pre-drying or pre-mixing.

  • Instantaneous Evaporative Cooling: Ultra-fast residence time (seconds) ensures that product temperatures stay low, protecting thermally sensitive chemical and organic powders from heat damage.

  • Built-In Particle Classification: An integrated top classifier ring controls the maximum particle size leaving the drying zone, guaranteeing uniform powder fineness without secondary screening.

  • High Thermal Efficiency: Maximum surface-area contact inside the swirling fluid vortex maximizes heat transfer rates, significantly lowering fuel and power consumption per kg of evaporated water.

  • Compact Footprint: Space-saving vertical tower layout replaces energy-intensive tray dryers, calcining kilns, and multi-piece drying chains.

Technical Specifications & Capabilities

Parameter Specification / Range
Evaporation Capacity 50 kg/hr to 5,000+ kg/hr (Custom Sized)
Material of Construction (MOC) Carbon Steel, SS304, SS316, SS316L, Hastelloy
Inlet Temperature Range 120°C to 600°C+ (Depending on MOC & Heating Source)
Heating Medium Direct/Indirect Gas Fired, Oil Fired, Hot Air Radiator, Thermic Fluid
Control Automation Fully Automatic PLC + HMI Panel with Variable Speed Drives (VFD)

Applications Across Process Industries

  • Dyes, Pigments & Intermediates: Organic dyes, inorganic pigments, phthalocyanine green/blue, and optical brighteners.

  • Agrochemicals & Pesticides: Agrochemical filter cakes, fungicide bases, and technical pesticide powders.

  • Food & Bio-Products: Starch cakes, soy protein, gluten, distillers grains, and pectin extracts.

  • Minerals & Inorganic Salts: Carbonates, kaolin, metallic oxides, aluminum hydroxide, and silica filter cakes.

Frequently Asked Questions

Tray drying is a slow, labor-intensive batch process with uneven drying times. A swirl agitated spin flash dryer operates continuously, evaporating surface moisture in seconds while simultaneously milling wet cakes into a uniform, free-flowing powder with zero manual handling.

The classifier ring at the exit of the drying chamber acts as an aerodynamic barrier. Only particles that have reached the target dryness and fine micron size are light enough to pass through into the cyclone separator; un-dried or larger lumps are thrown back into the agitation zone.

Yes. We fabricate custom agitator rotors fitted with replaceable, wear-resistant hard-faced alloy tips (such as Tungsten Carbide or Stellite coatings) to resist erosion and mechanical wear caused by abrasive mineral or chemical slurries.

Related Products

Have a project in mind?

Talk to our engineers about your drying, evaporation or turnkey process requirement.